PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016454545.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 368aa    MW: 42324.6 Da    PI: 5.4763
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016454545.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF80.51.2e-251058250
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    +ie+ +nrqvtfskRrngilKK +ELSvLCd++va+i+fs++g+l  ys
  XP_016454545.1 10 KIESLTNRQVTFSKRRNGILKKIYELSVLCDVDVAIIMFSPSGRLTHYS 58
                    59********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-31160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.703161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.63E-26291IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-22323IPR002100Transcription factor, MADS-box
PfamPF003195.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-222338IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-223859IPR002100Transcription factor, MADS-box
PROSITE profilePS512976.624111204IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MGRSKLPLLK IESLTNRQVT FSKRRNGILK KIYELSVLCD VDVAIIMFSP SGRLTHYSRK  60
RRIEDVLSEL VNLPDSERGF YINNKESVLW NLRKIEIQDK FCDIERISPA YLNTNDTAKK  120
IQEEINGLHC KLDEAEGLLR IFEPDTQKLT SLHELDLCEK RLQVALNQVR QRMEQLSSNH  180
TSSYEDNMEQ INALLQYIDN TQAEDTMPSL EKSPYDLWLE LEDYSYTNYI NENNNSHLYA  240
TSETSSLTQS SMNLPSPIIY DAVSQTSVSG VTTYHKEGTF SSLTDENFKQ SQHSTRTFPT  300
LTLQTSFKFA KTEMETPTSA LRPAAPYLQA EAAASPNQQL PSSNIEEENY EISWLQPKMK  360
KLKYHHLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-14158158Myocyte-specific enhancer factor 2B
1tqe_Q3e-14158158Myocyte-specific enhancer factor 2B
1tqe_R3e-14158158Myocyte-specific enhancer factor 2B
1tqe_S3e-14158158Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755174e-67HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016454545.10.0PREDICTED: agamous-like MADS-box protein AGL104 isoform X3
TrEMBLK4C1L40.0K4C1L4_SOLLC; Uncharacterized protein
STRINGSolyc05g051830.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.12e-47AGAMOUS-like 104